2.75 Rating by CuteStat

apluspk.net is 6 years 11 months old. It is a domain having net extension. It has a global traffic rank of #14742315 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. We found potential security risks with apluspk.net and it is Un-SAFE to browse this website. USE CAUTION and make sure you have best Antivirus Software installed.

PageSpeed Score
65
Siteadvisor Rating
Serious Risk Issues

Traffic Report

Daily Unique Visitors: 33
Daily Pageviews: 66

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Serious Risk Issues
WOT Trustworthiness: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Alexa Rank: 14,742,315
Domain Authority: Not Applicable

Web Server Information

Hosted IP Address:

163.172.101.239

Hosted Country:

France FR

Location Latitude:

48.8582

Location Longitude:

2.3387
Aplus PK - Non Stop Entertainment Portal

Page Resources Breakdown

Homepage Links Analysis

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: Not Applicable H4 Headings: 6
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 1
Google Adsense: Not Applicable Google Analytics: Not Applicable

HTTP Header Analysis

HTTP/1.1 200 OK
Date: Tue, 23 May 2017 01:06:26 GMT
Server: Apache
Link: <http://apluspk.net/wp-json/>; rel="https://api.w.org/"
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8

Domain Information

Domain Registrar: Network Solutions, LLC
Registration Date: May 17, 2017, 12:00 AM 6 years 11 months 1 week ago
Last Modified: May 17, 2017, 12:00 AM 6 years 11 months 1 week ago
Expiration Date: May 17, 2018, 12:00 AM 5 years 11 months 2 weeks ago
Domain Status:
clientTransferProhibited

DNS Record Analysis

Host Type TTL Extra
apluspk.net A 14399 IP: 163.172.101.239
apluspk.net NS 86399 Target: ns1.streammint.net
apluspk.net NS 86399 Target: ns2.streammint.net
apluspk.net SOA 86399 MNAME: ns1.streammint.net
RNAME: apnapakforum.gmail.com
Serial: 2017022103
Refresh: 3600
Retry: 7200
Expire: 1209600
Minimum TTL: 86400
apluspk.net MX 14399 Target: apluspk.net
apluspk.net TXT 14399 TXT: v=spf1 +a +mx +ip4:163.172.101.239 ~all

Similarly Ranked Websites

403 Forbidden

- sportlenon.com
14,742,357 $ 8.95

Little Owl | Preschool – DaycareLittle Owl

- littleowl-indonesia.com
14,742,375 $ 8.95

Watch Movies Online Streaming and Download - WatchMoviesKay

- watchmovieskay.net

Browse movies at watchmovieskay.net. You can watch and download as much movies as you want The Jungle Book,Term Life,Ratchet & Clank

14,742,383 $ 8.95


Certifed Female Friendly Around Thousand Oaks, CA | Certified Female F

- askpattycertifiedfemalefriendly.com
14,742,507 $ 8.95