Web Analysis for Apluspk - apluspk.net
2.75
Rating by CuteStat
apluspk.net is 6 years 11 months old. It is a domain having net extension. It has a global traffic rank of #14742315 in the world. This website is estimated worth of $ 8.95 and have a daily income of around $ 0.15. We found potential security risks with apluspk.net and it is Un-SAFE to browse this website. USE CAUTION and make sure you have best Antivirus Software installed.
PageSpeed Score
65
Siteadvisor Rating
Serious Risk Issues
Traffic Report
Daily Unique Visitors: | 33 |
Daily Pageviews: | 66 |
Estimated Valuation
Income Per Day: | $ 0.15 |
Estimated Worth: | $ 8.95 |
Search Engine Indexes
Google Indexed Pages: | Not Applicable |
Bing Indexed Pages: | Not Applicable |
Search Engine Backlinks
Google Backlinks: | Not Applicable |
Bing Backlinks: | Not Applicable |
Safety Information
Google Safe Browsing: | No Risk Issues |
Siteadvisor Rating: | Serious Risk Issues |
WOT Trustworthiness: | Not Applicable |
WOT Child Safety: | Not Applicable |
Website Ranks & Scores
Alexa Rank: | 14,742,315 |
Domain Authority: | Not Applicable |
Web Server Information
Page Resources Breakdown
Homepage Links Analysis
Website Inpage Analysis
H1 Headings: | 1 | H2 Headings: | 1 |
H3 Headings: | Not Applicable | H4 Headings: | 6 |
H5 Headings: | Not Applicable | H6 Headings: | Not Applicable |
Total IFRAMEs: | Not Applicable | Total Images: | 1 |
Google Adsense: | Not Applicable | Google Analytics: | Not Applicable |
HTTP Header Analysis
HTTP/1.1 200 OK
Date: Tue, 23 May 2017 01:06:26 GMT
Server: Apache
Link: <http://apluspk.net/wp-json/>; rel="https://api.w.org/"
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Date: Tue, 23 May 2017 01:06:26 GMT
Server: Apache
Link: <http://apluspk.net/wp-json/>; rel="https://api.w.org/"
Transfer-Encoding: chunked
Content-Type: text/html; charset=UTF-8
Domain Information
DNS Record Analysis
Host | Type | TTL | Extra |
---|---|---|---|
apluspk.net | A | 14399 |
IP: 163.172.101.239 |
apluspk.net | NS | 86399 |
Target: ns1.streammint.net |
apluspk.net | NS | 86399 |
Target: ns2.streammint.net |
apluspk.net | SOA | 86399 |
MNAME: ns1.streammint.net RNAME: apnapakforum.gmail.com Serial: 2017022103 Refresh: 3600 Retry: 7200 Expire: 1209600 Minimum TTL: 86400 |
apluspk.net | MX | 14399 |
Target: apluspk.net |
apluspk.net | TXT | 14399 |
TXT: v=spf1 +a +mx +ip4:163.172.101.239 ~all |
Similarly Ranked Websites
Watch Movies Online Streaming and Download - WatchMoviesKay
- watchmovieskay.net
Browse movies at watchmovieskay.net. You can watch and download as much movies as you want The Jungle Book,Term Life,Ratchet & Clank
14,742,383
$
8.95
Join larsitogames.com now and enjoy a cool collection of logic games,
- larsitogames.com
14,742,420
$
8.95
Certifed Female Friendly Around Thousand Oaks, CA | Certified Female F
- askpattycertifiedfemalefriendly.com
14,742,507
$
8.95